PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 232aa    MW: 25527.9 Da    PI: 4.7589
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634217.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.16.4e-43561551100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  XP_013634217.1  56 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCTGAIYHLQRQVSELQAQLA 150
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++ e
  XP_013634217.1 151 KTQVE 155
                     99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3655156IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4256153IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MLKMEINGGT SAATPTASAV AVATVKETTT PINSPSPTSL PPPPPLSPQQ TVVLSPCAAC  60
KILRRRCAEK CVLAPYFPPT DPAKFTIAHR VFGASNIIKF LQELPESQRT DAVNSMVYEA  120
GARMRDPVYG CTGAIYHLQR QVSELQAQLA KTQVELVSMQ LQRSDLLELL YKMEQTKLAA  180
QEQGQQNMSF ESSFESGDEF ISSPDEVTND LGFLEDNNNN NSSKSWWDPL WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892990.0AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634217.11e-174PREDICTED: LOB domain-containing protein 11
SwissprotQ9SK081e-132LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D3C2L21e-174A0A0D3C2L2_BRAOL; Uncharacterized protein
STRINGBra035698.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-107LOB domain-containing protein 11